Return to main results Retrieve Phyre Job Id

Job DescriptionP37306
Confidence10.87%DateThu Jan 5 11:55:07 GMT 2012
Rank67Aligned Residues31
% Identity35%Templatec3etjB_
PDB info PDB header:lyaseChain: B: PDB Molecule:phosphoribosylaminoimidazole carboxylase atpase PDBTitle: crystal structure e. coli purk in complex with mg, adp, and2 pi
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........
Predicted Secondary structure 














Query SS confidence 
















































Query Sequence  MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRLAIVH
Query Conservation 

 



 




               
      
  
  
  




Alig confidence 





.





...............










..







Template Conservation 

 


.

 
  ...............      

   ..
  
  

Template Sequence  MKQVCV. LGNGQL. . . . . . . . . . . . . . . GRMLRQAGEPL. . GIAVWPVG
Template Known Secondary structure 

.

S.................T

Template Predicted Secondary structure 

.


...............
..

Template SS confidence 
















































   1..... ...10.. .......20... ......30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions