Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7A7
Confidence11.32%DateThu Jan 5 11:05:13 GMT 2012
Rank37Aligned Residues22
% Identity27%Templated2cqna1
SCOP infoAnother 3-helical bundle FF domain FF domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   352.......360.... .....370...
Predicted Secondary structure 





.........
Query SS confidence 












. . . . . . . . .








Query Sequence  IRRTFKGNKLYST. . . . . . . . . VFREYLGEL
Query Conservation 




  
 

  .........

  

  
Alig confidence 












.........








Template Conservation         



 

    


 

 


  
Template Sequence  IRERFVKEPAFEDITLESERKRIFKDFMHVL
Template Known Secondary structure  TTST


Template Predicted Secondary structure 




Template SS confidence 






























   770.........780.........790.........800
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions