Return to main results Retrieve Phyre Job Id

Job DescriptionP42597
Confidence50.70%DateThu Jan 5 12:01:42 GMT 2012
Rank55Aligned Residues28
% Identity21%Templatec1l6jA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:matrix metalloproteinase-9; PDBTitle: crystal structure of human matrix metalloproteinase mmp92 (gelatinase b).
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   92.......100.........110.........120.........130..
Predicted Secondary structure 















Query SS confidence 








































Query Sequence  GGKLKAKVEIRVATVFRNAPEPFLRMIVVHELAHLKEKEHN
Query Conservation 



  
  
  
  
   
     


 


 

    
 
Alig confidence 












.............














Template Conservation 
 

      
  .............




 

 


 

Template Sequence  WGFCPDQGYSLFL. . . . . . . . . . . . . VAAHEFGHALGLDHS
Template Known Secondary structure 


S
.............TT



Template Predicted Secondary structure 









.............




Template SS confidence 








































   385....390....... ..400.........410..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions