Return to main results Retrieve Phyre Job Id

Job DescriptionP42597
Confidence72.37%DateThu Jan 5 12:01:42 GMT 2012
Rank19Aligned Residues29
% Identity21%Templatec1eakA_
PDB info PDB header:hydrolase/hydrolase inhibitorChain: A: PDB Molecule:72 kda type iv collagenase; PDBTitle: catalytic domain of prommp-2 e404q mutant
Resolution2.66 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   91........100.........110.........120.........130..
Predicted Secondary structure 
















Query SS confidence 









































Query Sequence  QGGKLKAKVEIRVATVFRNAPEPFLRMIVVHELAHLKEKEHN
Query Conservation 




  
  
  
  
   
     


 


 

    
 
Alig confidence 





.............






















Template Conservation   
  
 .............  
  
  




 

 


 

Template Sequence  KWGFCP. . . . . . . . . . . . . DQGYSLFLVAAHQFGHAMGLEHS
Template Known Secondary structure 


.............


TT



Template Predicted Secondary structure 





.............










Template SS confidence 









































   386...390. ........400.........410....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions