Return to main results Retrieve Phyre Job Id

Job DescriptionP30192
Confidence3.69%DateThu Jan 5 11:46:17 GMT 2012
Rank50Aligned Residues22
% Identity18%Templatec1h6wA_
PDB info PDB header:structural proteinChain: A: PDB Molecule:bacteriophage t4 short tail fibre; PDBTitle: crystal structure of a heat- and protease-stable fragment2 of the bacteriophage t4 short fibre
Resolution1.9 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   103......110.........120.........130.........140
Predicted Secondary structure 
















Query SS confidence 





































Query Sequence  EWLFRQTAQDRGAERYLKDDWHGLQLFAIDGAQFRTPD
Query Conservation    

   
            
 
 

 




    

Alig confidence 












................








Template Conservation    
   

  


................    
 


Template Sequence  PLYASRIGTRYGG. . . . . . . . . . . . . . . . SSSNPGLPD
Template Known Secondary structure  TTTTSB................
SSSBB

B
Template Predicted Secondary structure 

................








Template SS confidence 





































   373......380..... ....390....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions