Return to main results Retrieve Phyre Job Id

Job DescriptionP0A935
Confidence11.58%DateThu Jan 5 11:09:17 GMT 2012
Rank66Aligned Residues45
% Identity20%Templatec3a52A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:cold-active alkaline phosphatase; PDBTitle: crystal structure of cold-active alkailne phosphatase from2 psychrophile shewanella sp.
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   177..180.........190.........200.........210.........220.........230.........240
Predicted Secondary structure 























Query SS confidence 































































Query Sequence  FIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSE
Query Conservation 










 



   
 
 


 

 

 



 

  
 
     


 

 

  

 
Alig confidence 







...........
.

















.......

















Template Conservation 







........... .

 
 
 

    
 
  ....... 

 

  

       
Template Sequence  FVLLVEGS. . . . . . . . . . . L. IDWAGHNNDIATAMAEMQ. . . . . . . GFANAIEVVEQYIRQHPD
Template Known Secondary structure  T............TT
.......

S
Template Predicted Secondary structure 
...........
.








.......



Template SS confidence 































































   217..220.... . ....230.........240... ......250.........260.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions