Return to main results Retrieve Phyre Job Id

Job DescriptionP16917
Confidence15.45%DateWed Jan 25 15:20:40 GMT 2012
Rank20Aligned Residues37
% Identity24%Templatec3k8hA_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:30klp; PDBTitle: structure of crystal form i of tp0453
Resolution2.39 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1314.....1320.........1330.........1340.........1350.........1360..
Predicted Secondary structure 































Query SS confidence 
















































Query Sequence  STAPNRGERKGSYPFNSPCPNGTEKVSAYHTHGADSHGEYWDEIFSGKD
Query Conservation                                                   
Alig confidence 


























............









Template Conservation 







 
    
 

 






 ............ 








Template Sequence  RTTAVYGAFFARSKEFRLFGSGSYPYA. . . . . . . . . . . . FTNLIFSRSD
Template Known Secondary structure  TTTTT


............TTSS
GGG
Template Predicted Secondary structure 








............



Template SS confidence 
















































   78.80.........90.........100.... .....110....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions