Return to main results Retrieve Phyre Job Id

Job DescriptionQ46898
Confidence1.55%DateThu Jan 5 12:35:38 GMT 2012
Rank85Aligned Residues34
% Identity12%Templatec2yvuA_
PDB info PDB header:transferaseChain: A: PDB Molecule:probable adenylyl-sulfate kinase; PDBTitle: crystal structure of ape1195
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50
Predicted Secondary structure 
























Query SS confidence 

















































Query Sequence  MRSYLILRLAGPMQAWGQPTFEGTRPTGRFPTRSGLLGLLGACLGIQRDD
Query Conservation 
   
 


 






       
 
   
 



 







  
 
Alig confidence 














................


















Template Conservation 
 

 

 
 
  

................





  

  
      
Template Sequence  IEKGIVVWLTGLPGS. . . . . . . . . . . . . . . . GKTTIATRLADLLQKEGYR
Template Known Secondary structure 
S



TTS................STT

Template Predicted Secondary structure 








................






Template SS confidence 

















































   10.........20.... .....30.........40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions