Return to main results Retrieve Phyre Job Id

Job DescriptionQ46898
Confidence1.46%DateThu Jan 5 12:35:38 GMT 2012
Rank93Aligned Residues26
% Identity27%Templatec2rh5B_
PDB info PDB header:transferaseChain: B: PDB Molecule:adenylate kinase; PDBTitle: structure of apo adenylate kinase from aquifex aeolicus
Resolution2.48 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40......
Predicted Secondary structure 

















Query SS confidence 









































Query Sequence  LILRLAGPMQAWGQPTFEGTRPTGRFPTRSGLLGLLGACLGI
Query Conservation 
 


 






       
 
   
 



 







 
Alig confidence 










................














Template Conservation 


 
 
  

................



 
  

  
  
Template Sequence  MILVFLGPPGA. . . . . . . . . . . . . . . . GKGTQAKRLAKEKGF
Template Known Secondary structure 


TTS................


Template Predicted Secondary structure 





................


Template SS confidence 









































   1........10. ........20......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions