Return to main results Retrieve Phyre Job Id

Job DescriptionP76045
Confidence3.43%DateThu Jan 5 12:17:48 GMT 2012
Rank97Aligned Residues25
% Identity28%Templatec2hzsG_
PDB info PDB header:transcriptionChain: G: PDB Molecule:rna polymerase ii mediator complex subunit 20; PDBTitle: structure of the mediator head submodule med8c/18/20
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   52.......60.........70.........80.
Predicted Secondary structure 













Query SS confidence 





























Query Sequence  EPSVYFNAANGPWRIALAYYQEGPVDYSAG
Query Conservation     
 

     
 
 
        
    
Alig confidence 



.....




















Template Conservation 
   .....  






 

 
  
 
  
Template Sequence  ILSV. . . . . RDPWSIDFRTYRCSIKNLPAD
Template Known Secondary structure 

.....





SS

SS
Template Predicted Secondary structure 
.....












Template SS confidence 





























   28.30. ........40.........50..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions