Return to main results Retrieve Phyre Job Id

Job DescriptionP36683
Confidence13.32%DateThu Jan 5 11:53:49 GMT 2012
Rank81Aligned Residues43
% Identity26%Templatec3imoC_
PDB info PDB header:unknown functionChain: C: PDB Molecule:integron cassette protein; PDBTitle: structure from the mobile metagenome of vibrio cholerae.2 integron cassette protein vch_cass14
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   511........520.........530.........540.........550.........560.........570......
Predicted Secondary structure 






















Query SS confidence 

































































Query Sequence  GSGLVAFAAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLTVEKKGKKNIFSG
Query Conservation 
 



 




  









 


 
  








 
   
   
 


        
 
Alig confidence 
























..........



.............













Template Conservation   
  




 
 

   
   
 
 ..........  

.............




 







Template Sequence  NVEEIALALAGAILWRKDDTNIKVM. . . . . . . . . . AKNV. . . . . . . . . . . . . LWVTINGERYAFSY
Template Known Secondary structure  GGB
SS
..........


.............TT
Template Predicted Secondary structure 






..........

.............

Template SS confidence 

































































   28.30.........40.........50.. .... ...60.........70
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions