Return to main results Retrieve Phyre Job Id

Job DescriptionP36683
Confidence16.27%DateThu Jan 5 11:53:49 GMT 2012
Rank54Aligned Residues27
% Identity19%Templatec2yb1A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:amidohydrolase; PDBTitle: structure of an amidohydrolase from chromobacterium violaceum (efi2 target efi-500202) with bound mn, amp and phosphate.
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   454.....460.........470.........480.........490.........500.
Predicted Secondary structure 





















Query SS confidence 















































Query Sequence  VNTHHTLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTR
Query Conservation 
   
 

 

 
 

     
 






 
   

 








 
Alig confidence 
















.....................









Template Conservation           

   
  .....................

 




  
Template Sequence  LDDMHKFALHADRHGLY. . . . . . . . . . . . . . . . . . . . . ASSGSDFHAP
Template Known Secondary structure  T
.....................

B
ST
Template Predicted Secondary structure 


.....................





Template SS confidence 















































   226...230.........240.. .......250..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions