Return to main results Retrieve Phyre Job Id

Job DescriptionP76938
Confidence11.95%DateThu Jan 5 12:25:24 GMT 2012
Rank80Aligned Residues28
% Identity32%Templated1sr9a1
SCOP infoRuvA C-terminal domain-like post-HMGL domain-like DmpG/LeuA communication domain-like
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   71........80.........90.........100.........110.
Predicted Secondary structure 















Query SS confidence 








































Query Sequence  RRELVDFGYWYCPDGRDAQTQSQFEDVEVKPQALDWLFCVA
Query Conservation 

 
 





 




  

  

 









 
  
Alig confidence 






.........




....















Template Conservation 






.........
  

....  



  

  
  
Template Sequence  RRLQIEF. . . . . . . . . SQVIQ. . . . KIEVSPKEXWDAFAEE
Template Known Secondary structure  .............T



Template Predicted Secondary structure 
.............

Template SS confidence 








































   451...... ..460.. .......470........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions