Return to main results Retrieve Phyre Job Id

Job DescriptionP24200
Confidence21.74%DateThu Jan 5 11:41:10 GMT 2012
Rank26Aligned Residues45
% Identity29%Templatec2p57A_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:gtpase-activating protein znf289; PDBTitle: gap domain of znf289, an id1-regulated zinc finger protein
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   190.........200.........210.........220.........230.........240.........250. ....
Predicted Secondary structure 






















...
Query SS confidence 





























































. . .



Query Sequence  VRDPMVKAWILQQSKGICENCGKNAPFYLNDGNPYLEVHHVIPLSSGGADTTDNCVALCPNC. . . HREL
Query Conservation 







 












  


  


 











 

 












...



Alig confidence 




























.....................











...



Template Conservation       
  
   
 
  




   
 

.....................
   




  





 
Template Sequence  EIQTLFKRLRAVPTNKACFDCGAKNPSWA. . . . . . . . . . . . . . . . . . . . . SITYGVFLCIDCSGVHRSL
Template Known Secondary structure  SGGGGB
TTT

BS

.....................GGGT
Template Predicted Secondary structure 











.....................





Template SS confidence 




































































   910.........20.........30....... ..40.........50......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions