Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9R4
Confidence84.93%DateThu Jan 5 11:11:04 GMT 2012
Rank65Aligned Residues26
% Identity42%Templatec1tkeA_
PDB info PDB header:ligaseChain: A: PDB Molecule:threonyl-trna synthetase; PDBTitle: crystal structure of the editing domain of threonyl-trna2 synthetase complexed with serine
Resolution1.46 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30...
Predicted Secondary structure 














Query SS confidence 
































Query Sequence  MPKIVILPHQDLCPDGAVLEANSGETILDAALR
Query Conservation 



 
       
 
 

    
 


 
   
Alig confidence 





.......



















Template Conservation 
  
 
.......


       


  


  
Template Sequence  MPVITL. . . . . . . PDGSQRHYDHAVSPMDVALD
Template Known Secondary structure 


.......TTS

SS
B
Template Predicted Secondary structure 


.......









Template SS confidence 
































   1..... ...10.........20......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions