Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7B1
Confidence22.32%DateThu Jan 5 11:05:15 GMT 2012
Rank120Aligned Residues29
% Identity24%Templated3c7bb2
SCOP infoFerredoxin-like Nitrite/Sulfite reductase N-terminal domain-like DsrA/DsrB N-terminal-domain-like
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70.........80.......
Predicted Secondary structure 










Query SS confidence 








































Query Sequence  DEFYKVRFAELKRRIIISEEQGSNSHSRHLLGKIQSRVLKA
Query Conservation 








 
              

 


  
   
   
Alig confidence 







...........


.

















Template Conservation      



...........  
.  






 







Template Sequence  DVIYVVRF. . . . . . . . . . . GTP. RLLSIYTVRELCDIADKY
Template Known Secondary structure 
...........


.SS

Template Predicted Secondary structure 
...........


.



Template SS confidence 








































   4950...... ... 60.........70.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions