Return to main results Retrieve Phyre Job Id

Job DescriptionP46883
Confidence12.78%DateThu Jan 5 12:04:33 GMT 2012
Rank52Aligned Residues42
% Identity24%Templatec2rfuA_
PDB info PDB header:viral proteinChain: A: PDB Molecule:influenza b hemagglutinin (ha); PDBTitle: crystal structure of influenza b virus hemagglutinin in complex with2 lstc receptor analog
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   660.........670......... 680.........690.........700.........710.........720.
Predicted Secondary structure 









...
























Query SS confidence 



















. . .









































Query Sequence  RLSFMDKQLWVTRYHPGERF. . . PEGKYPNRSTHDTGLGQYSKDNESLDNTDAVVWMTTGTTHVA
Query Conservation 

 

   



 
 
 
  ...


 
 


    

  
    


   




 
 
  


Alig confidence 



















...







............




....



...



.
Template Conservation    





 


 
  
   
     

 

............
  

....

 
...



.
Template Sequence  GNGFFATMAWAVPKNKTATNPLTVEVPYICT. . . . . . . . . . . . KGEDQ. . . . ITVW. . . GFHS. D
Template Known Secondary structure  S



TTSS











S............TT
........
Template Predicted Secondary structure 











............



.......
.
Template SS confidence 
































































   149150.........160.........170......... 180.... .... .190.. .
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions