Return to main results Retrieve Phyre Job Id

Job DescriptionP37443
Confidence27.79%DateThu Jan 5 11:55:38 GMT 2012
Rank174Aligned Residues38
% Identity13%Templatec2amjD_
PDB info PDB header:oxidoreductaseChain: D: PDB Molecule:modulator of drug activity b; PDBTitle: crystal structure of modulator of drug activity b from escherichia2 coli o157:h7
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   663......670.........680.........690....... ..700.........710.........720
Predicted Secondary structure 






















....








Query SS confidence 


































. . . .






















Query Sequence  HHGSNTSSSLPLIQRVNGKVALASASRYNAWRLPS. . . . NKVKHRYQLQGYQWIDTPHQGQT
Query Conservation 



 



  

  
 
  



 
  





 .... 


 

         
   
 
Alig confidence 





.............



.......




....






















Template Conservation       
.............



....... 

 
  
       
   
  
         
Template Sequence  HHHSSN. . . . . . . . . . . . . ILII. . . . . . . NGAKNDTLTEVADGTLRDLGHDVRIVRADSDY
Template Known Secondary structure 




....................



TTT
TTS

Template Predicted Secondary structure 




....................











Template SS confidence 





























































   5....10 .... .....20.........30.........40......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions