Return to main results Retrieve Phyre Job Id

Job DescriptionP76073
Confidence5.23%DateThu Jan 5 12:18:12 GMT 2012
Rank16Aligned Residues26
% Identity15%Templated3blhb1
SCOP infoCyclin-like Cyclin-like Cyclin
Resolution2.48

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   38.40.........50.........60.........
Predicted Secondary structure 
Query SS confidence 































Query Sequence  RTLLDYIEGNIKKTSWLDNKELLQTAISVLKD
Query Conservation 



 
      
    
 
   



 

 
Alig confidence 










......














Template Conservation    

   
 
 ......    
 
 

   

Template Sequence  THVVKCTQLVR. . . . . . ASKDLAQTSYFMATN
Template Known Secondary structure  TTT......

Template Predicted Secondary structure 

......

Template SS confidence 































   155....160..... ....170.........180
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions