Return to main results Retrieve Phyre Job Id

Job DescriptionP76073
Confidence4.84%DateThu Jan 5 12:18:12 GMT 2012
Rank20Aligned Residues26
% Identity15%Templated2ivxa2
SCOP infoCyclin-like Cyclin-like Cyclin
Resolution1.8

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   38.40.........50.........60.........
Predicted Secondary structure 
Query SS confidence 































Query Sequence  RTLLDYIEGNIKKTSWLDNKELLQTAISVLKD
Query Conservation 



 
      
    
 
   



 

 
Alig confidence 










......














Template Conservation 
 

   
 
 ......    
 
 

  


Template Sequence  TDVVKCTQLVR. . . . . . ASKDLAQTSYFMATN
Template Known Secondary structure  TT......

Template Predicted Secondary structure 

......

Template SS confidence 































   154.....160.... .....170.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions