Return to main results Retrieve Phyre Job Id

Job DescriptionP36881
Confidence33.03%DateThu Jan 5 11:53:56 GMT 2012
Rank29Aligned Residues35
% Identity17%Templatec3ho6B_
PDB info PDB header:toxinChain: B: PDB Molecule:toxin a; PDBTitle: structure-function analysis of inositol hexakisphosphate-2 induced autoprocessing in clostridium difficile toxin a
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50........
Predicted Secondary structure 



















Query SS confidence 
























































Query Sequence  LGWVITCHDDRAQEILDALEKKHGALLQCRAVNFWRGLSSNMLSRMMCDALHEADSG
Query Conservation 
 


 


  
 

  
   
 
    
  
              
   
      
Alig confidence 









......................
























Template Conservation 








 ......................  


 
   

  
          
Template Sequence  VKVTFIGHNT. . . . . . . . . . . . . . . . . . . . . . SEFARLSVDSLSNEISSFLDTIKLD
Template Known Secondary structure 



......................STTTTT
Template Predicted Secondary structure 


......................






Template SS confidence 
























































   106...110..... ....120.........130.........140
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions