Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADM4
Confidence1.66%DateThu Jan 5 11:21:21 GMT 2012
Rank45Aligned Residues27
% Identity7%Templatec2e5zA_
PDB info PDB header:rna binding proteinChain: A: PDB Molecule:splicing factor, arginine/serine-rich 8; PDBTitle: solution structure of the surp2 domain in splicing factor,2 arginine/serine-rich 8
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   75....80.........90.........100.........
Predicted Secondary structure 


















Query SS confidence 


































Query Sequence  WDVFRKDSSVRSRVEKSEANAQATNAVIPPARMPD
Query Conservation 


     
    
   
          
      
Alig confidence 





........




















Template Conservation    

  ........

     
           
 
Template Sequence  NAYYEF. . . . . . . . KKQFFLQKEGGDSMQAVSAPE
Template Known Secondary structure  ........T











Template Predicted Secondary structure 
........














Template SS confidence 


































   64..... 70.........80.........90
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions