Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADM4
Confidence1.68%DateThu Jan 5 11:21:21 GMT 2012
Rank42Aligned Residues19
% Identity37%Templatec1tuuA_
PDB info PDB header:transferaseChain: A: PDB Molecule:acetate kinase; PDBTitle: acetate kinase crystallized with atpgs
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   61........70.. .......
Predicted Secondary structure  ............
Query SS confidence 











. . . . . . . . . . . .






Query Sequence  DMPFTAVMDTLL. . . . . . . . . . . . LPWDVFR
Query Conservation 






 



............




  
Alig confidence 











............






Template Conservation      








  

  
  



     
Template Sequence  GTPMVIVFDTAFHQTMPPYAYMYALPYDLYE
Template Known Secondary structure  TS
TTGGGGG



SS
Template Predicted Secondary structure 
















Template SS confidence 






























   140.........150.........160.........170
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions