Return to main results Retrieve Phyre Job Id

Job DescriptionQ9JMS9
Confidence3.65%DateThu Jan 5 12:38:05 GMT 2012
Rank22Aligned Residues33
% Identity24%Templatec2i5kB_
PDB info PDB header:transferaseChain: B: PDB Molecule:utp--glucose-1-phosphate uridylyltransferase; PDBTitle: crystal structure of ugp1p
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10...... ...20.........30......
Predicted Secondary structure 



...........................


Query SS confidence 












. . . . . . . . . . . . . . . . . . . . . . . . . . .



















Query Sequence  RLRFSGPKTSIIC. . . . . . . . . . . . . . . . . . . . . . . . . . . SPMTSLKTSIKTITYLSDIG
Query Conservation         
  
  ...........................     
         
 
 
Alig confidence 












...........................



















Template Conservation 


   


   
    


 
   

  
       


 



  
   
   
  

Template Sequence  SMGCVGPKSVIEVREGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNTDKDTEHLIKKYS
Template Known Secondary structure  GGTGGGSTTTT




TTTGGGS
Template Predicted Secondary structure 























Template SS confidence 



























































   116...120.........130.........140.........150.........160.........170.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions