Return to main results Retrieve Phyre Job Id

Job DescriptionP77179
Confidence6.64%DateThu Jan 5 12:26:01 GMT 2012
Rank33Aligned Residues42
% Identity26%Templated1hynp_
SCOP infoPhoshotransferase/anion transport protein Phoshotransferase/anion transport protein Anion transport protein, cytoplasmic domain
Resolution2.60

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   144.....150.........160.........170.........180.........190.........200.........210.....
Predicted Secondary structure 























Query SS confidence 







































































Query Sequence  VLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRA
Query Conservation 


 





 




      
                  
  






 

 
 
           
  
Alig confidence 













.....







.............






............












Template Conservation 

 






  

.....






 .............   
 
 ............   
    


 
Template Sequence  LLHSLEGFLDCSLV. . . . . LPPTDAPS. . . . . . . . . . . . . EQALLSL. . . . . . . . . . . . VPVQRELLRRRYQ
Template Known Secondary structure  T


.....




S
.............S............T
Template Predicted Secondary structure 


.....





.............



............




Template SS confidence 







































































   307..310.........320 ........ .330..... ....340........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions