Return to main results Retrieve Phyre Job Id

Job DescriptionP77179
Confidence6.48%DateThu Jan 5 12:26:01 GMT 2012
Rank36Aligned Residues50
% Identity16%Templatec1hynQ_
PDB info PDB header:membrane proteinChain: Q: PDB Molecule:band 3 anion transport protein; PDBTitle: crystal structure of the cytoplasmic domain of human2 erythrocyte band-3 protein
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   144.....150.........160.........170.........180.........190.........200.........210.........220...
Predicted Secondary structure 































Query SS confidence 















































































Query Sequence  VLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRAEAAAERAL
Query Conservation 


 





 




      
                  
  






 

 
 
           
          
Alig confidence 













.....







.............









.............
















Template Conservation 

 






  

.....






 .............   
 
    .............
    


       
 
Template Sequence  LLHSLEGFLDCSLV. . . . . LPPTDAPS. . . . . . . . . . . . . EQALLSLVPV. . . . . . . . . . . . . QRELLRRRYQSSPAKPD
Template Known Secondary structure  T


.....

S



.............TTTT.............SSSS



Template Predicted Secondary structure 


.....





.............






.............








Template SS confidence 















































































   307..310.........320 ........ .330........ .340.........350.....
 
   224
Predicted Secondary structure 
Query SS confidence 
Query Sequence  P
Query Conservation   
Alig confidence 
Template Conservation   
Template Sequence  S
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 
   356
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions