Return to main results Retrieve Phyre Job Id

Job DescriptionQ2A0L0
Confidence79.36%DateThu Jan 5 12:33:38 GMT 2012
Rank56Aligned Residues35
% Identity34%Templatec3ikmD_
PDB info PDB header:transferaseChain: D: PDB Molecule:dna polymerase subunit gamma-1; PDBTitle: crystal structure of human mitochondrial dna polymerase2 holoenzyme
Resolution3.24 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   96...100.........110.........120.........130.........140...
Predicted Secondary structure 





















Query SS confidence 















































Query Sequence  KTCILGYNNVRFDDEVTRNIFYRNFYDPYAWSWQHDNSRWDLLDVMRA
Query Conservation    





 
 

  

   
 
    
            
 


 

Alig confidence 







.













..........






..





Template Conservation 







.







 


 
..........  
  

..





Template Sequence  EQLVVGHN. VSFDRAHIREQYLI. . . . . . . . . . QGSRMRF. . LDTMSM
Template Known Secondary structure  S






.STTSTTT..........T





..

Template Predicted Secondary structure 



.


..........



..
Template SS confidence 















































   263......270 .........280.... .....290. ......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions