Return to main results Retrieve Phyre Job Id

Job DescriptionP11875
Confidence40.04%DateThu Jan 5 11:32:57 GMT 2012
Rank109Aligned Residues34
% Identity32%Templatec3d0qB_
PDB info PDB header:transferaseChain: B: PDB Molecule:protein calg3; PDBTitle: crystal structure of calg3 from micromonospora echinospora determined2 in space group i222
Resolution2.79 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   114.....120.........130.........140.........150.......
Predicted Secondary structure 













Query SS confidence 











































Query Sequence  TIVVDYSAPNVAKEMHVGHLRSTIIGDAAVRTLEFLGHKVIRAN
Query Conservation   
 

  











 
 

 

 


 

  
  
    
Alig confidence 



.





......






...
















Template Conservation 


 .      ......

     ... 

  
  


 
   
Template Sequence  RVLF. VSSPGI. . . . . . GHLFPLI. . . QLAWGFRTAGHDVLIAV
Template Known Secondary structure  .

SST......TSSGGG...TT
Template Predicted Secondary structure  .




.........



Template SS confidence 











































   0... ...... 10...... ...20.........30...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions