Return to main results Retrieve Phyre Job Id

Job DescriptionP11875
Confidence25.00%DateThu Jan 5 11:32:57 GMT 2012
Rank122Aligned Residues35
% Identity31%Templatec2iyfA_
PDB info PDB header:transferaseChain: A: PDB Molecule:oleandomycin glycosyltransferase; PDBTitle: the crystal structure of macrolide glycosyltransferases: a2 blueprint for antibiotic engineering
Resolution1.7 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   114.....120.........130.........140.........150........
Predicted Secondary structure 














Query SS confidence 












































Query Sequence  TIVVDYSAPNVAKEMHVGHLRSTIIGDAAVRTLEFLGHKVIRANH
Query Conservation   
 

  











 
 

 

 


 

  
  
     
Alig confidence 



.





......






...

















Template Conservation   

 .      ......


   
... 

  
  


 
 
 
 
Template Sequence  HIAM. FSIAAH. . . . . . GHVNPSL. . . EVIRELVARGHRVTYAIP
Template Known Secondary structure  .

S
......GGG...TT

Template Predicted Secondary structure  .




.........



Template SS confidence 












































   8.10. ...... ..20.... .....30.........40..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions