Return to main results Retrieve Phyre Job Id

Job DescriptionP18006
Confidence7.43%DateThu Jan 5 11:36:33 GMT 2012
Rank72Aligned Residues41
% Identity17%Templatec3pgvB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:haloacid dehalogenase-like hydrolase; PDBTitle: crystal structure of a haloacid dehalogenase-like hydrolase2 (kpn_04322) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at3 2.39 a resolution
Resolution2.39 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   46...50.........60.........70.........80.........90.........100...
Predicted Secondary structure 








Query SS confidence 

























































Query Sequence  VTVAFNMKQTVDAFFDSASQKQLSEAQSKALSARFNTALEASLQAWQQKHHAVILVSP
Query Conservation   

 



 

  
  
 
   

 

  
 
 

  


 

      
 




  
Alig confidence 












.....










............
















Template Conservation 


  





  .....    
      ............ 
  
   
  
   

Template Sequence  QVVASDLDGTLLS. . . . . PDHFLTPYAKE. . . . . . . . . . . . TLKLLTARGINFVFATG
Template Known Secondary structure  S




S
.....TTS


............TT

S
Template Predicted Secondary structure 






.....





............




Template SS confidence 

























































   3......10..... ....20...... ...30.........40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions