Return to main results Retrieve Phyre Job Id

Job DescriptionP18006
Confidence23.45%DateThu Jan 5 11:36:33 GMT 2012
Rank11Aligned Residues44
% Identity25%Templatec1xviA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:putative mannosyl-3-phosphoglycerate phosphatase; PDBTitle: crystal structure of yedp, phosphatase-like domain protein2 from escherichia coli k12
Resolution2.26 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   43......50.........60.........70.........80.........90.........100...
Predicted Secondary structure 











Query SS confidence 




























































Query Sequence  NAPVTVAFNMKQTVDAFFDSASQKQLSEAQSKALSARFNTALEASLQAWQQKHHAVILVSP
Query Conservation    
 

 



 

  
  
 
   

 

  
 
 

  


 

      
 




  
Alig confidence 















.....






............




















Template Conservation      

  






 .....    
  ............    

  
   
      

Template Sequence  QQPLLVFSDLDGTLLD. . . . . SHSYDWQ. . . . . . . . . . . . PAAPWLTRLREANVPVILCSS
Template Known Secondary structure 



TTTTS
.....SS

S

............TTTT


S
Template Predicted Secondary structure 









.....





............




Template SS confidence 




























































   5....10.........20 ....... ..30.........40........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions