Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAR3
Confidence4.91%DateThu Jan 5 11:13:33 GMT 2012
Rank55Aligned Residues37
% Identity19%Templated1of5b_
SCOP infoCystatin-like NTF2-like NTF2-like
Resolution2.8

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   56...60.........70.........80.........90.........100.........110.........120....
Predicted Secondary structure 





































Query SS confidence 




































































Query Sequence  MKHLAVAVTPVAGQLDLKKVAKALGAKKVEMADPMVAQRSTGYLVGGISPLGQKKRLPTIIDAPAQEFA
Query Conservation       
 
       
 
 
   

      
  
      
   
 
 
 
    
 

 
  
    
Alig confidence 















..............................







..












Template Conservation 
 

 
   
 




..............................

  

 
..
  
 

 
    
Template Sequence  GSGTLICNVNCKVRFD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . WGPYFGIS. . LQLIIDDRIFRND
Template Known Secondary structure  TTT

..............................



..GGGGGT
Template Predicted Secondary structure 


..............................



..




Template SS confidence 




































































   90.........100..... ....110... ......120......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions