Return to main results Retrieve Phyre Job Id

Job DescriptionP33354
Confidence2.52%DateThu Jan 5 11:51:55 GMT 2012
Rank80Aligned Residues31
% Identity13%Templated1p4xa2
SCOP infoDNA/RNA-binding 3-helical bundle "Winged helix" DNA-binding domain MarR-like transcriptional regulators
Resolution2.20

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   115....120.........130.........140.........150...
Predicted Secondary structure 

















Query SS confidence 






































Query Sequence  FKALQGISGINVSAEDAKKGITMAQMELVMKAAGFKEVK
Query Conservation     
                

 
 
 
 
 
 





Alig confidence 












........

















Template Conservation    


  
 
   ........ 

  
  

  
 
 
 
Template Sequence  LKDLIETIHHKYP. . . . . . . . QTVRALNNLKKQGYLIKE
Template Known Secondary structure  SSS
........TSS
Template Predicted Secondary structure 


........
Template SS confidence 






































   177..180......... 190.........200.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions