Return to main results Retrieve Phyre Job Id

Job DescriptionP33354
Confidence3.98%DateThu Jan 5 11:51:55 GMT 2012
Rank37Aligned Residues45
% Identity16%Templatec3pptA_
PDB info PDB header:lipid binding proteinChain: A: PDB Molecule:sodium-calcium exchanger; PDBTitle: rep1-nxsq fatty acid transporter
Resolution1.28 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   36...40.........50.........60.........70.........80.........90.........100.........
Predicted Secondary structure 


















Query SS confidence 









































































Query Sequence  LNGTEIAITYVYKGDKVLKQSSETKIQFASIGATTKEDAAKTLEPLSAKYKNIAGVEEKLTYTDTYAQENVTID
Query Conservation   

     

 



 
 


    
 
  

   

 

   
     

 
 

    
 

   



 

Alig confidence 



















.............................
























Template Conservation   

   
   
 

 


  ............................. 
  
     

  
  
  
 
  
Template Sequence  GDGRKIKTTCKIDGNAMIQD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . QKGSPDSILSREVKDGKMHMILKVN
Template Known Secondary structure  TT

TT.............................SSS
TTT
Template Predicted Secondary structure 





.............................








Template SS confidence 









































































   76...80.........90..... ....100.........110.........120
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions