Return to main results Retrieve Phyre Job Id

Job DescriptionP33354
Confidence7.95%DateThu Jan 5 11:51:55 GMT 2012
Rank14Aligned Residues41
% Identity15%Templatec3em0A_
PDB info PDB header:lipid binding proteinChain: A: PDB Molecule:ileal bile acid-binding protein; PDBTitle: crystal structure of zebrafish ileal bile acid-bindin protein2 complexed with cholic acid (crystal form b).
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   37..40.........50.........60.........70.........80.........90.........100.........
Predicted Secondary structure 

















Query SS confidence 








































































Query Sequence  NGTEIAITYVYKGDKVLKQSSETKIQFASIGATTKEDAAKTLEPLSAKYKNIAGVEEKLTYTDTYAQENVTID
Query Conservation 

     

 



 
 


    
 
  

   

 

   
     

 
 

    
 

   



 

Alig confidence 
























................................















Template Conservation 

   
   
 

 


        ................................ 


 
  

 
 
  
Template Sequence  GGKKFKGIVSMEGGKLTISFPKYQQ. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . TTEISGGKLVETSTAS
Template Known Secondary structure  T



TT
SS................................TT
Template Predicted Secondary structure 








................................


Template SS confidence 








































































   75....80.........90......... 100.........110.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions