Return to main results Retrieve Phyre Job Id

Job DescriptionP75745
Confidence14.82%DateThu Jan 5 12:13:41 GMT 2012
Rank75Aligned Residues26
% Identity38%Templatec3ju0A_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:phage integrase; PDBTitle: structure of the arm-type binding domain of hai7 integrase
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   251........260.........270.........280.........290.........300.
Predicted Secondary structure 













Query SS confidence 


















































Query Sequence  TTGGYPRIACIIEADMYHLAQIPLGQPIHFVQCSLEEALKARQDQQRYFEQ
Query Conservation 





 
  
   

  


  

  


  

 


          
  
Alig confidence 






.........................


















Template Conservation   

 

 ......................... 

  

  
         
Template Sequence  ALGVYPA. . . . . . . . . . . . . . . . . . . . . . . . . VSLADARQRRDEAKKLLAA
Template Known Secondary structure  TT.........................S
T
Template Predicted Secondary structure 





.........................


Template SS confidence 


















































   52...... .60.........70.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions