Return to main results Retrieve Phyre Job Id

Job DescriptionP31660
Confidence4.39%DateThu Jan 5 11:48:24 GMT 2012
Rank79Aligned Residues19
% Identity26%Templatec3lgoA_
PDB info PDB header:protein bindingChain: A: PDB Molecule:protein slm4; PDBTitle: structure of gse1p, member of the gse/ego complex
Resolution2.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   259260........ .270.......
Predicted Secondary structure 



...........








Query SS confidence 









. . . . . . . . . . .








Query Sequence  IRKRVENKEV. . . . . . . . . . . VIGFGHPVY
Query Conservation 
   
     ...........
 



 

Alig confidence 









...........








Template Conservation 








 
    


        



Template Sequence  IKDKWSEDENDTHSNSCYPVEIDSFKTKIY
Template Known Secondary structure  TTTT



SSB

TT
Template Predicted Secondary structure 
















Template SS confidence 





























   76...80.........90.........100.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions