Return to main results Retrieve Phyre Job Id

Job DescriptionP00803
Confidence57.84%DateThu Jan 5 10:56:51 GMT 2012
Rank12Aligned Residues22
% Identity45%Templatec3i4oA_
PDB info PDB header:translationChain: A: PDB Molecule:translation initiation factor if-1; PDBTitle: crystal structure of translation initiation factor 1 from2 mycobacterium tuberculosis
Resolution1.47 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   96...100.........110.........120.........130..
Predicted Secondary structure 

























Query SS confidence 




































Query Sequence  LLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIV
Query Conservation 
  

 




  

 
 
           
 




Alig confidence 













...............







Template Conservation 
  

 
 
     ...............
  




Template Sequence  ILPEDRVVVELSPY. . . . . . . . . . . . . . . DLSRGRIV
Template Known Secondary structure 

TT
TT...............
Template Predicted Secondary structure 






...............



Template SS confidence 




































   48.50.........60. ........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions