Return to main results Retrieve Phyre Job Id

Job DescriptionP0AG40
Confidence29.20%DateThu Jan 5 11:28:03 GMT 2012
Rank120Aligned Residues54
% Identity28%Templatec2by0A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:maltooligosyltrehalose trehalohydrolase; PDBTitle: is radiation damage dependent on the dose-rate used during2 macromolecular crystallography data collection
Resolution1.55 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   75....80.........90.........100.........110.........120.........130.... .....140.....
Predicted Secondary structure 

























.........

Query SS confidence 



























































. . . . . . . . .










Query Sequence  LREKLRYLAECGVDYVLCVRFDRRFAALTAQNFISDLLVKHLRVKFLAVGDDFRFGAGRE. . . . . . . . . GDFLLLQKAGM
Query Conservation   
 
   
   


 
    
      
  
 

  

   
    



 

 

    .........
    
     
Alig confidence 























.........................










.........










Template Conservation 
  





 





 
 

   .........................     


      
 
   

  


 

 
Template Sequence  AAEKLPYLKELGVTAIQVXPLAAF. . . . . . . . . . . . . . . . . . . . . . . . . DGQRGWGYDGAAFYAPYAPYGRPEDLXALVD
Template Known Secondary structure  TTT





.........................SSS


STT


GGG

Template Predicted Secondary structure 








.........................





















Template SS confidence 















































































   146...150.........160......... 170.........180.........190.........200
 
   146. ..150...
Predicted Secondary structure 
...

Query SS confidence 

. . .





Query Sequence  EY. . . GFDITS
Query Conservation    ...
  
 
Alig confidence 

...





Template Conservation   

  

 


Template Sequence  AAHRLGLGVFL
Template Known Secondary structure  TT
Template Predicted Secondary structure 


Template SS confidence 










   201........210.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions