Return to main results Retrieve Phyre Job Id

Job DescriptionP39347
Confidence5.52%DateThu Jan 5 11:59:37 GMT 2012
Rank91Aligned Residues32
% Identity19%Templated1rw6a_
SCOP infoSTAT-like CAPPD, an extracellular domain of amyloid beta A4 protein CAPPD, an extracellular domain of amyloid beta A4 protein
Resolution2.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   350.........360.........370.........380.........390
Predicted Secondary structure 










Query SS confidence 








































Query Sequence  RAAYIHKAEHLEERRLMLQWWADFLDVNRERFISPFEYAKI
Query Conservation     
 
    
  
          
                
Alig confidence 







...














......








Template Conservation   

 
 

... 


 


 
  

 ......  


   
Template Sequence  ARVEAMLN. . . DRRRLALENYITALQ. . . . . . AVPPRPRHV
Template Known Secondary structure  ...T......
SS

Template Predicted Secondary structure  .........



Template SS confidence 








































   440....... ..450.........460.. .......470.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions