Return to main results Retrieve Phyre Job Id

Job DescriptionP39347
Confidence7.24%DateThu Jan 5 11:59:37 GMT 2012
Rank72Aligned Residues32
% Identity19%Templatec1f8aB_
PDB info PDB header:isomeraseChain: B: PDB Molecule:peptidyl-prolyl cis-trans isomerase nima- PDBTitle: structural basis for the phosphoserine-proline recognition2 by group iv ww domains
Resolution1.84 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   33......40.........50.........60.........70.........80
Predicted Secondary structure 










Query SS confidence 















































Query Sequence  EITLADARVRRDEARKLLANGVDPGDKKKNDKVEQSKARTFKEVAIEW
Query Conservation    
   

  
         
                  
  
     
Alig confidence 




















................










Template Conservation     
 

   
  
   
  
................   
  

   
Template Sequence  TRTKEEALELINGYIQKIKSG. . . . . . . . . . . . . . . . EEDFESLASQF
Template Known Secondary structure 


TT................SS
Template Predicted Secondary structure 
................


Template SS confidence 















































   83......90.........100... ......110....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions