Return to main results Retrieve Phyre Job Id

Job DescriptionP20343
Confidence5.59%DateThu Jan 5 11:37:47 GMT 2012
Rank15Aligned Residues30
% Identity27%Templatec3d3zA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:actibind; PDBTitle: crystal structure of actibind a t2 rnase
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.... .....20.........30..
Predicted Secondary structure 






.............









Query SS confidence 











. . . . . . . . . . . . .

















Query Sequence  RHRLQHHGTCAN. . . . . . . . . . . . . LRAAPNFNIAEDFRARAN
Query Conservation 











.............

















Alig confidence 











.............

















Template Conservation   


 






     
            

  

 
  
 
Template Sequence  EHEWNKHGTCINTIEPSCYTDYYAQEEVGDFFQQVVDLFKTLD
Template Known Secondary structure  TGGG
GGGSGGGBSS

TTTT

Template Predicted Secondary structure 



















Template SS confidence 










































   109110.........120.........130.........140.........150.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions