Return to main results Retrieve Phyre Job Id

Job DescriptionP25736
Confidence14.71%DateThu Jan 5 11:42:21 GMT 2012
Rank10Aligned Residues16
% Identity38%Templated2evra1
SCOP infoSH3-like barrel Prokaryotic SH3-related domain Spr N-terminal domain-like
Resolution1.60

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   96...100.........110.........120......
Predicted Secondary structure 


















Query SS confidence 






























Query Sequence  QCWQDGGRKNCAKDPVYRKMESDMHNLQPSV
Query Conservation   

  



 
   
    
 





 


Alig confidence 


...............












Template Conservation   

...............
   

 

 

 
Template Sequence  PGW. . . . . . . . . . . . . . . LSLSDFDSLQPAT
Template Known Secondary structure  ...............GGGGGG
S
Template Predicted Secondary structure 
...............








Template SS confidence 






























   65.. ..70.........80
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions