Return to main results Retrieve Phyre Job Id

Job DescriptionP25736
Confidence18.86%DateThu Jan 5 11:42:21 GMT 2012
Rank7Aligned Residues23
% Identity22%Templatec2lmdA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:prospero homeobox protein 1; PDBTitle: minimal constraints solution nmr structure of prospero homeobox2 protein 1 from homo sapiens, northeast structural genomics consortium3 target hr4660b
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   176...180... ......190........
Predicted Secondary structure 
...........




Query SS confidence 







. . . . . . . . . . .














Query Sequence  YFYMRDQY. . . . . . . . . . . NLTLSRQQTQLFNAW
Query Conservation   


  

...........   

     

  
Alig confidence 







...........














Template Conservation 










  

 








  






Template Sequence  LMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKW
Template Known Secondary structure  TT

S
TSS



Template Predicted Secondary structure 









Template SS confidence 

































   27..30.........40.........50.........60
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions