Return to main results Retrieve Phyre Job Id

Job DescriptionP24241
Confidence4.67%DateThu Jan 5 11:41:33 GMT 2012
Rank72Aligned Residues31
% Identity16%Templatec1kftA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:excinuclease abc subunit c; PDBTitle: solution structure of the c-terminal domain of uvrc from e-2 coli
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10.........20.........30.........40.........50...
Predicted Secondary structure 













Query SS confidence 















































Query Sequence  AALARSVIAALGGVDNISAVTHCMTRLRFVIKDDALIDSPTLKTIPGV
Query Conservation     
  
   


  

    

 



  


        
     
Alig confidence 



















.................










Template Conservation     
  
   
 
   
  
.................
 


  
 

Template Sequence  PKRRQMLLKYMGGLQGLRNA. . . . . . . . . . . . . . . . . SVEEIAKVPGI
Template Known Secondary structure  SSS

.................
TTSSST
Template Predicted Secondary structure 


.................




Template SS confidence 















































   34.....40.........50... ......60....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions