Return to main results Retrieve Phyre Job Id

Job DescriptionP60438
Confidence6.73%DateThu Jan 5 12:06:48 GMT 2012
Rank62Aligned Residues23
% Identity13%Templatec1ep3B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:dihydroorotate dehydrogenase b (pyrk subunit); PDBTitle: crystal structure of lactococcus lactis dihydroorotate dehydrogenase2 b. data collected under cryogenic conditions.
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7980.........90.........100.........
Predicted Secondary structure 














Query SS confidence 






























Query Sequence  LWEFRLAEGEEFTVGQSISVELFADVKKVDV
Query Conservation 
 



        
  
    
  

 


Alig confidence 











........










Template Conservation 
  
 
      ........    




 
Template Sequence  IFEMVLKGTLVD. . . . . . . . EMDLPGQFLHL
Template Known Secondary structure  SGGGG........G

STT
Template Predicted Secondary structure 




........





Template SS confidence 






























   20.........30. ........40..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions