Return to main results Retrieve Phyre Job Id

Job DescriptionP76080
Confidence24.43%DateThu Jan 5 12:18:21 GMT 2012
Rank58Aligned Residues27
% Identity33%Templatec2x5cB_
PDB info PDB header:viral proteinChain: B: PDB Molecule:hypothetical protein orf131; PDBTitle: crystal structure of hypothetical protein orf131 from2 pyrobaculum spherical virus
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   95....100.........110.........120.........130...
Predicted Secondary structure 




























Query SS confidence 






































Query Sequence  WMTPDARERLREYGISPPAGHSCHAHLPPEVRCPRCASV
Query Conservation   

 


  

  




            
 

 
 
 
Alig confidence 















............










Template Conservation 















............










Template Sequence  DMAADLVRMLRGLGVF. . . . . . . . . . . . MHAKCPRCGAE
Template Known Secondary structure  T

............

TTT

Template Predicted Secondary structure  ............








Template SS confidence 






































   34.....40......... 50.........60
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions