Return to main results Retrieve Phyre Job Id

Job DescriptionP76080
Confidence22.58%DateThu Jan 5 12:18:21 GMT 2012
Rank72Aligned Residues25
% Identity24%Templatec2f5qA_
PDB info PDB header:hydrolase/dnaChain: A: PDB Molecule:formamidopyrimidine-dna glycosidase; PDBTitle: catalytically inactive (e3q) mutm crosslinked to oxog:c2 containing dna cc2
Resolution2.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   126...130.........140.........150.....
Predicted Secondary structure 














Query SS confidence 





























Query Sequence  RCPRCASVHTTLISEFGSTACKALYRCDSC
Query Conservation   

 
 
  
   
 

 
 



  
  
Alig confidence 






.








....








Template Conservation   

 

 . 
     

....
 
  

 
Template Sequence  PCKRCGT. PIEKTVVAG. . . . RGTHYCPRC
Template Known Secondary structure  B
TTT

.BBTT....
TTT
Template Predicted Secondary structure 






.

....



Template SS confidence 





























   248.250.... .....260... ......270..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions