Return to main results Retrieve Phyre Job Id

Job DescriptionP64439
Confidence9.96%DateThu Jan 5 12:08:20 GMT 2012
Rank4Aligned Residues29
% Identity28%Templated1fo8a_
SCOP infoNucleotide-diphospho-sugar transferases Nucleotide-diphospho-sugar transferases N-acetylglucosaminyltransferase I
Resolution1.40

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   87..90.........100.........110.........120.....
Predicted Secondary structure 



Query SS confidence 






































Query Sequence  RSFWQELAWLLSAVFWCALGALCFLFISSLFKPQHRKNQ
Query Conservation 

 





  





  


  

  

      
 
Alig confidence 


















..........









Template Conservation 
  
 

   

   

  .......... 
    
  
Template Sequence  AELWAELEPKWPKAFWDDW. . . . . . . . . . MRRPEQRKGR
Template Known Secondary structure  GGG

SS
..........TSTT
Template Predicted Secondary structure 







..........









Template SS confidence 






































   275....280.........290... ......300...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions