Return to main results Retrieve Phyre Job Id

Job DescriptionP04152
Confidence57.83%DateThu Jan 5 10:58:12 GMT 2012
Rank76Aligned Residues42
% Identity24%Templatec1d8lA_
PDB info PDB header:gene regulationChain: A: PDB Molecule:protein (holliday junction dna helicase ruva); PDBTitle: e. coli holliday junction binding protein ruva nh2 region2 lacking domain iii
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   138.140.........150.........160.........170........ .180.........190.....
Predicted Secondary structure 












...






Query SS confidence 








































. . .
















Query Sequence  GIAQTKTLAKLANHAAKKWQRQTGGVVDLSNLERQRKLMSA. . . LPVDDVWGIGRRISKKL
Query Conservation 


 
  





   

      
   
         
  ...


  
 


      
Alig confidence 












................











...
















Template Conservation 




 

 


 ................    

  

   
   
 





 





Template Sequence  GVGPKLALAILSG. . . . . . . . . . . . . . . . MSAQQFVNAVEREEVGALVKLPGIGKKTAERL
Template Known Secondary structure  T

................S
TT
STT

Template Predicted Secondary structure 



................








Template SS confidence 




























































   80.........90.. .......100.........110.........120....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions